home *** CD-ROM | disk | FTP | other *** search
/ Source Code 1994 March / Source_Code_CD-ROM_Walnut_Creek_March_1994.iso / compsrcs / x / volume20 / xboing / part11 < prev    next >
Encoding:
Text File  |  1993-09-03  |  53.8 KB  |  575 lines

  1. Newsgroups: comp.sources.x
  2. From: jck@kimba.catt.citri.edu.au (Justin Kibell)
  3. Subject: v20i118:  xboing - a simple blockout type game, Part11/26
  4. Message-ID: <1993Sep3.123309.7454@sparky.sterling.com>
  5. X-Md4-Signature: 11cc040bfc52778d19eceb62f62d9788
  6. Sender: chris@sparky.sterling.com (Chris Olson)
  7. Organization: Sterling Software
  8. Date: Fri, 3 Sep 1993 12:33:09 GMT
  9. Approved: chris@sterling.com
  10.  
  11. Submitted-by: jck@kimba.catt.citri.edu.au (Justin Kibell)
  12. Posting-number: Volume 20, Issue 118
  13. Archive-name: xboing/part11
  14. Environment: X11, xpm, color
  15.  
  16. #! /bin/sh
  17. # This is a shell archive.  Remove anything before this line, then feed it
  18. # into a shell via "sh file" or similar.  To overwrite existing files,
  19. # type "sh file -c".
  20. # Contents:  bitmaps/background10.xpm bitmaps/presents.xpm xboing.man
  21. # Wrapped by chris@sparky on Fri Sep  3 07:14:45 1993
  22. PATH=/bin:/usr/bin:/usr/ucb:/usr/local/bin:/usr/lbin ; export PATH
  23. echo If this archive is complete, you will see the following message:
  24. echo '          "shar: End of archive 11 (of 26)."'
  25. if test -f 'bitmaps/background10.xpm' -a "${1}" != "-c" ; then 
  26.   echo shar: Will not clobber existing file \"'bitmaps/background10.xpm'\"
  27. else
  28.   echo shar: Extracting \"'bitmaps/background10.xpm'\" \(17329 characters\)
  29.   sed "s/^X//" >'bitmaps/background10.xpm' <<'END_OF_FILE'
  30. X/* XPM */
  31. Xstatic char *background10_xpm[] = {
  32. X/* width height ncolors chars_per_pixel */
  33. X"128 128 20 1",
  34. X/* colors */
  35. X"` c #502C1D",
  36. X"a c #603926",
  37. X"b c #683920",
  38. X"c c #582E1A",
  39. X"d c #663121",
  40. X"e c #82412C",
  41. X"f c #874F34",
  42. X"g c #6B3929",
  43. X"h c #905839",
  44. X"i c #73462D",
  45. X"j c #743727",
  46. X"k c #7A4026",
  47. X"l c #502717",
  48. X"m c #86492E",
  49. X"n c #3F1D12",
  50. X"o c #5A2F1F",
  51. X"p c #733C20",
  52. X"q c #6B3D28",
  53. X"r c #734229",
  54. X"s c #642E1D",
  55. X/* pixels */
  56. X"efhkeldsddekmkeeemejbrrigdgjmiioo`ssppsbbisdgfihfkggdgigollbddbggqaolosqbbbqs`obdpjrbo``ospmmmrrkid`acoagl`prgaoaaigollbpbeekrss",
  57. X"pkbbalnclogekkmejkkrermemrrrqpbgo`nospcgkisoiifhhkdoooqcocabadgpppjo`ccbbbeii`o`ddpprgslocbjeiipfhfo``oogoliiiaairbgc`lbbsdbgocj",
  58. X"ddg`annnnldskfhmmmfhkjiemierjbbca``lcssbbsssdpkfhmgjgggdobbcspbbrkqoodbgjkkfiid`lospkkdoo`cbbrgjmhfiaooaqaaphffihgaadllcccooao`d",
  59. X"ajgaonnnn`ojkhhhimhmkpjibrpjgqaono``no`all`ogkiehfehffic`cddqarkmhkqgdgjjifmmiraaosspkigdcoobqrqmmmiqagqbgasjfiijg`nllnnlaobqb`g",
  60. X"beehhg`nnnorffhhhmheisaagdppkkkb`llnnlccln`ogjrfmhfhffiosaasbgppjefkrfkpbimkipbgoolosjbribbbjkrieiikkrrgbaq`bihmg``nadddjjdbgfii",
  61. X"isskep`nnndjmhhhemmmrbgqgqbjjkpd`nn`nnllnlodihffhffehhkbjpgpmikmkkmfhhferihmkpbcaooccsjrqgqrpkrimekekprid`a`cremidnnbrkskdddgbbp",
  62. X"gigfffglnldskmhmeemergireirpbbbjdc`ocnllc`bkmhhhhfimhhiirgpeekkfhpihfhhijjhfrigoloooloogao`absjkhfmmejkffo``o`mmhipqqiejggdgfigg",
  63. X"`caairfc`adbcbrjjhfmffemmfjjbdaqb`gqa``nlokmfhhhhhhmhmhppgemefkfhhhhhffhfmffmrpolclllcbbqfodqfjehmmmjekhfia`l`skmfpirifkdoooiqig",
  64. X"`oo`giiborerboosjmmmhekeheppbrgrjdgqgsccllsjemfhhhemmmkkbpppkefmmmhhhffhhmmmiqc`nn``l`odrfibfiepfhmppkmmmiiaaosspmmipefmggggggoa",
  65. X"nnnniibbopjikiiqkmkhmfmhhmkmjkmmedjeijpgblccssemhfekejjbadkkkehhhhhhhhefeipppbsclcafoloppffrffepfhfepkmfikpjdoloskprkehfeffficn`",
  66. X"o`naifgqbpiiriqgjpkmhhhfmmimkmhherkjkmkiiqaacbcbrjgmjjoooojjejefhemehffbddsscooo``gfi``drippffmsmmfjkjeeeppbgbblcssdjjehhhfhfg`o",
  67. X"hiiirmikbrffrigrfhkehhhfefjimmeefrkiekmkfhfiiiboolokjdocdogrkjpmhmeemmegdgggdsdclsddaoarkijqqfmkekppdgdkeijaoadoldaejpbmhkhheifq",
  68. X"fhfhiiifemmmhifphhmphhfkkjmmffkkeiifiereefmeggriq``figdsccsqrpdkerjgjbdgjdkgoloccsaaocdrffejemmkpsjrfibrkpjadccodsihfijihhfhhhhp",
  69. X"fmekkmmfhmmhhhfihhmkhhhmkjmfhhhbiegdiefmekmkigrfioakhkrbcorpsddqcddqmfeeejigssbbgdggdcqeehhmhhebbmmmrbdqcdcarkpijgifhiirhhfmhhhk",
  70. X"kjjpjgjkkmeehhiihhhphhhkmjkmmmkkredloereemkpiiqibagdefrisjippjjcccggfeeppbdbqgqdjgqgdspkmhhmhmkkmhhmkpibbsggmmmppcobkffmhhffiiki",
  71. X"golbbggqjjjjeheqrhhmhhfmkjbeejgsigg``oibfhhmrriagagdkfpkdbembjqblcaqkepjsssjpkjpmemicdgmhmhfkmrmfhmhmrkrsbaqempjsllcbkkkmfhkjlab",
  72. X"lblqbjpspdjjmfmrfhfmfmhfijdiejooaaga``oskhfmrrkirqqdphfkkkkpsbrsllodpppbclllbdpehfmejlimpkeemefmhfemhmidclodpppbcnnldoobsbssdlad",
  73. X"ddsgjjbbsqkkkmhhhhhmmhhmpbdrrga`ddrgalllrefmipfffhjjrhhikepgsqag`nlcbpbglnnnlbbemhhhfqffssssbpkepmmhfidolnlbpkbbclnclccnnlllocpo",
  74. X"saoiefiebbppkkhmhhhimhhkkqariiaagrpqc`lldrrejkmhffhfmfhfmpjooaoaanl`grigonnnnlgdkmhhffijdsbscpbdeeffmkd`ln`kfmkpgcpjmeja`l`cgbpd",
  75. X"iaaapbmkmdkkggmmfhhhmhhmbgojfiiifgjbo``ldbrqrrffmihhmhhhkesa`aaigollbrpid`nnnloosmmhmhhfqaiaoocjiifmhhgoolomkpkkpjkmfeeiolscsjmg",
  76. X"pbooggkmpppeicpefmfemmmpbdbsdijrkjso```ccddqqikmiimemkekpjdoarrbgcolapkpslnnnnlloimieemkbgjrgjgrffffhhfii`immfmbefmmmjhembssskki",
  77. X"kaaldgfmjbpkrcsrpmejkeddcooobiemeejda`qiqbqjirikeejjjjdbcggaqfgaagccdrikba`nnnl`lgifmerkjimeppprhhfhefmiacbfhmieaarkpkmhhmpssdmi",
  78. X"sqqocirejjprbcgasbdsrggl````sbjpmmkjdooiggkrggpgjppdddgddogodgd````looiqrqannnnnnlkreempqerppprpekmefmhgiiihmpijiikfhkehhmpsdgjg",
  79. X"oaq`cqogfoabbco```l`aao```oobbgefmmfrbrmprkjrjrppsddddgegooggdl`n``anlbrpiqonnn`nloibfhhmpkebssdseffjhmiffqhkmfhfhkhhmphhmscdrbo",
  80. X"gogodcskiocagoosolllbaacdgbabbjpmfmfhfhhmkkmepbgbodocsekisssdbonn```llbprgq`nnnnl``oskhfmrkkaooggbmmhfhhhigiihhhhhihhmkhhfjcsesd",
  81. X"alaoclddjosdjpjbdccoaigbdjjjbirpmmmmhmhhmkkhebbqeggolcgjerdscggsoaaa`aarrrolnl``ddlllrefmipmiglolopmhmphfioobfhhhiihhhphhhkrcbga",
  82. X"biqbloodollsgdgoibgoggdoojdgeiogjmmhhhhhhfkhmisqjqbalnllgqpblspsoaqa`laspsglnnloscolldrrejjmfkacclodmegmhadlbfhhheqrhhmhhfmjsjpb",
  83. X"mirbooolllllssdgddbgdcoodosjeirllsjemfhhhemmebdbiiiollllbdddncbradqqo``sbbo`nlbdgdoocdprqrrfekrbsqclbjbeead`bfhhhmrfhfmfmhfigsbp",
  84. X"keiegg`llbcsddgfiggjragqgrrfhhfqcclssemhfekesosdkkrdd`nllllcclbsajjbg``lccllncsbpboodcdgqqikipbcssclsdpjjijbdhhfhhhhhhmmhhmpgsbp",
  85. X"ppikiballbbdoooiqiaocgrjimmfhhffiaacbcbrjgkjg`oagperrascllllcddboaqpga`llclclsrkkablddrqgriikpsslllclclbsqjobmmfhhhhhhimhhkkrpcs",
  86. X"biimiioosjkggggggoa`oreekmmhfhmhhfiiiboolopgdabgbpikpbccll`cdbao`l``ollnll`lodgjsqqocabjbdgrigao`n`lclnlsri`dihhhhhhhhhmhhhbiqos",
  87. X"odjkpjgrkmmeffficn`nlcpemkkfmieefmeggria`liggqqgbpfmpbdoolcsbpqqccnnnnnnnllccqdooaq`cbcagagikkpslnnnclcosjkdlifjemfhhhemmmkpbbcl",
  88. X"lsbdbegrekhhhfhfgl``oskhmkkeifmekmkigrfqoobiqqiirkhmksdslloodbaolnnnnnnnnllllkpdgogodcspbddbqbalnnnnlobbjjgddimcssemhfekejgsqad`",
  89. X"nldpprmepbmhkhheifqfiiffmjjgkreemkpiiqidaoccarkfjmmepsccccbadbccccnnnnnnlclcsgiaalaoclddgcsbsbdlnnnnnodgbdoocbdacbcbrjgmejooaooc",
  90. X"clcbkfhmirihhfhhhfpmhifmekdooibfhhmrgidbaalncbimjkejdsaddcdbaolnnnnnlnllccsbckkbbiqblood`lcccloabb`gadgegocllbjiiibooloiigaoaago",
  91. X"llloeehhiirhhfmhhhmffjeppjao`oskhfmrgrqdoolllcbggmejooaobaoddalloo`oo`ccaddpggqpmirboooll`ocspmpeeegireekppclldjdgriq`lieraajpdo",
  92. X"olprmhffhhfhhffiikrbrjjjpdddlllrefmipmipccllll`loiigaoaagdocdoclabooa`olqbbkrsrkeeiegg`nnnnldefhffmfjrfedbdgbclsdsbib``pirrpedo`",
  93. X"lcskffffhhmhhhkeldscldaoadblllldrrejrkijdoodsia``ffiaaipbdcooaoodgoaaigbgrpppbbpppikibalnlnlspjpjmhhfpedddgsccnnllldl`llsrppgoln",
  94. X"lcsjmhhefeikkbbalnlnn`olodc`l`ldbrqqbmjadaabriiaakhffihgaodcbjiibccoarkbekegb``dbiifrroll`ll`jbdjhihfkggdgigo`nnnnllnnlldbejdc`n",
  95. X"losdpmmmdddddd`annnnnlllllo``lccddqbqbgdoadgpkpaasjfiijg```odefffgdigieipbssolnlgbpkpbl`l`cllabaiifhhkdoooiba`nnnnnnnnnlbbjpsbcl",
  96. X"ln`ssjppdcagfgb`nnnnn`gbocl``aaacbgggqgdddbsdgjag`bihmg``n``gsffekfifbddddo``lnlcssssdbd`l`loaggiikfhmgggggd``nnnnnnnnnbpipddsdc",
  97. X"lllllocsddsirrclnnnlpekkpsll```lodbdbrjgagoccaaao`cremidnn`oagkffffkmjdggfia``lolbodsbbacccoaprdimfmhfefffilnnnnnnnnnnnjiirbjgdo",
  98. X"o`lnllssadoagaolnnodehhejsccnncccaoaggqiiiiaqgigo`o`mmhibagaigrkfmfkrjgbmifbaccqgbrgpqraolabaikbjjemehhhfhfalnnnnnnllnlpbopsjjbo",
  99. X"boolnnlclscllallnnspkepjkbdo`lclssddgbgerihhmmmidal`skmfpgaqaabipikmmfigifffggdffrjejrrrcooscjibkhmpbmhkhheqicaonlllll`bccdcsmpd",
  100. X"blaoccdlollnnllnlncdejdgebsllnnlcddsbkiemehmhhhiraaosspmmibqraqbjlgpkifaggffhfmmhmipgspbbllllldqfhffrihhfhhficbas`onnnlccspbdpra",
  101. X"biqqbbbbclnnnnnnnlloiqairqa`nnnnn`dddjjemmeeeefhkrgon`skbrerbglcollbrrrmemmfhhkhhfpjldsao`nl``lgifhgirhhfmhmiqiqggalnl`bbrppskkb",
  102. X"mirbgbbcdb`nnnnlacbdiigjrppgaollnl`dgsspeemkfkkmiiiaolcssbqppgo``llbqpkemmhefeikkbballc```ocdbjgimehfmhhmfiibqbggo`nnnospbppggqp",
  103. X"eejegjddpjo`n`qqemmemidiiimibdqool`ooddiimekempifigqo`no`al``d`o``oqefjeefmmbddddd`annlllcosrfmmiimmmpfhhkeldsdjgadnnn`appemrsrk",
  104. X"ppipgsbcbdblsihemmhhhmrejkeikjjdabaalcaaqrfprfhfhfboclnlcccnllclolcsmmmjjekkgdggfiaonnln`labaprkjeeeemkkppgl`bpjpkkdaccbmpkkebbp",
  105. X"biiibjbiiiiifhpmekeefhkihepbkmdadooo`oo`biffbpkmfmbol`llllnn```oodojekkgdjbddgbfiisonnnlncapbeffmmmmeejjjggolcagdggfiisjkmmfralb",
  106. X"dssbeeerqjkphemmmmhkkmfhhfirkhirbcn`nnnniikkadjmfmes`lclsccnnlabaaodgbddgkfmfegiffid`nllccrpjjgpkjjjeeejjkpgssgsssgbbpksspkpplll",
  107. X"lsbremekpiifhemmmmhhpihfhhieehhffg`oo`naifda`scspeppoo`cl`llllcbddcbkmpijmmmppcooiiqcnlccjrpggsddjssjejdjkdbbsoosdkjgggjgrrejglo",
  108. X"llpkmefmimfffbpemjfhhhhhffhhhehfeifqhiiirralnll`dsbdgdgccclnnn`lcldgmkpbgrmpjsclcbpgollodbbsgcoogoccaqqoirbpjsllcdgbbdllaorpkcln",
  109. X"bjpmmemhhmago`spkmmmmhhhffmfhhfhhhhphhfhqqblnnnlsdsgsdsbcdlllclllcogkkssspppbcnnno`clclsccbjgaiiiiaqgijdgbsbssocdpjibdl```gjmgcb",
  110. X"rpppeehmkd`lllpjehhhhhhhhefehhmmhhhmhhffiffo`n`oddgiidooaaocabac```spbbccbpbglnnnnnnlcddlcdqbdgpihhmmmksadcollncokkqdo`llngjjscb",
  111. X"ibdeemmkpolln`pejkfhemehffppefmfiikikmmhhhrr`loalcoiqaoll`lcckifollcspcolbgigonnnnn`odgolcddqijeehmhhhebjcccnnnlsiergjaolcaesods",
  112. X"acrriejekcllndppjpmhmeemmejpmmhkeldsddikmmemqddggdgga``n`l`cgpffio`ldggclcqpid`nnnnloagqrddbkgbpmmeeeffpbpslnnnldpkpikibaccsoodd",
  113. X"irikijikrbdc`sppddkerjgjbddrpkbbalnclooggjjeiaddgqrqlnnnnllbbkkeir``obsaldbkpslnnnnlcdriidskppbkeikmpjekiislnnncdrpiifiiodcccgdi",
  114. X"iiifiiikipbbccssdsqcddqmfmejddd`annnnnnncojjmddjeiega```nn`bqbrqpdg`ocgsccgikbalnnncbdigcqbrkqrkpgremjqejgolnnns`djbpkkrdddlgbpk",
  115. X"eikpkikkirqaabobgjcccggfmmppdggaonnnnnnllikeeppepekgdrqfigbbdgdbbbca`ooscoogbrqannnobskgggdkjjjedgdrfheeis`lnnlqcbcsdddegrqdsbpk",
  116. X"ppsdpppppejgjjacagblcaqkmpjssdqssnnnnnllbgpejdjkkrerriqhhifbbbddqbono`ololldbsiqonlddbkbsdsjpdpdbspmmmfmkbclnngqlclccssbbbbsdsbp",
  117. X"scssssscssbdbdbcsrslcdgkppscloajdonlnlcbjipkddskpirirrpfhfmqifbcbdollllllccdsbda`nlccpkbgdsgjiiiiimhemmeekd`nnibobc`l`cdagdoodss",
  118. X"llllllcccdrfiiqbiijgasrkfkgdllddqbslccrqeekggopkiiiggbrpmmhhmkrcaconnn`lllcodsd`lnooskkiqcsdprpjkphmmemmmmpcl`poobbclnnlcllccll`",
  119. X"`llnlllommmrqjkpejkebjpkmfjrqdccsadacgkfhhkdcosjjjejsossdikmmffrbdolllllllcdscldonlcsbfipooldkpiiihemmmfhepblopccdscclnnnnllnllc",
  120. X"l`locskfhhmkpiiemrmmepmjjemfhiiaqbqjgiikfhmggssspppdclll`oggeehiboollllllbppslldalcbjkjdsaclsprkfmmppekmmgpjsbdcdgblgo`nnnllcclc",
  121. X"clclccmhhmhmremmipkekkefpifmffmfmmmidimfmhfkiasspppdcnnnnnncojppddlcclcjimmebcosolcljiboocblcrkmagddbikekloddobrikpcsbbba``dddsc",
  122. X"looqkmmhfemhkkpkpmkpjpmfhhhfmmhmhhhmrejemehhfrjgddddollnlnnnasbdddcclccmfhmhkssscldcsmpdgogosbrgolllpejij`loodoppikadakia`cl`ssl",
  123. X"llcbkkejmmmmjgbpekpbdrkmmhhfmhmeeefhkihmpbmhkmkbddsssocllolbabllodccqkmmhfeemiiqdbrqdriaalaccspd`lnofiibjlnlscoppmmgsqpkdcccsbcc",
  124. X"ccasibdjkmmmrspkeeiejikefhhhhmmmhkkmfhhffrihfimiipbirpkrrpsqisoncclcbkkepmehfmgbpkkkskkbbiqdcbrgdolbmdcooonlcclkpkmesbbpbcsssdcs",
  125. X"oqgsacqbkkkmmbbpppikqbqjpkpmmekkhhpihfhhiirhhikfiipffpkhmfkfegdllllgsibdjkfffeksqrrkgggpmipddbprjbldposldscggccbkehia`ddbbdbbpic",
  126. X"ifqqeibqpkehiq`bbiifikdgpscddbrpmhhhhhffhhfhhmfiikiemmmiipipkkeiclabdacrgifmfhmiprpkbsbkeereggddssccslnncsddpllcbkkkc`csdcccsiib",
  127. X"mikmmmsdbbkkkc`cgbpkkpddonnnnlcrkmmhhhffhhmhhhkejkpmhhjjn`lllocssogqiiiifmhmmemmkbrbbsbpppijgsssssccblnnllsspsllopppilocc``csbdp",
  128. X"jmmhfhpccdpppilocddddjbdlnnnnnldeemhhhhefeikkbpgdgppkss`nnnnnlllbbgkifkkmmemmmmkjrggbaobsppkbgcnllllllllnlllsllllbssclnlllsccsqp",
  129. X"jkmmmfp`llbssclnllcssbsclnnnnnnlojpppmmmssdsdgdbddsddonnnnnnnlnlsdgpmmkkkjekmmppjpjgiggosspssbsllnnnnobslcnncllnlsbsc`cclnllbpps",
  130. X"jpmmkhksl`sbsc`acll`cddcnnnnnnnnlocsjjppscdgekjgdodgiaonnnnnllo`dogbbmpgsiiimmkrpppikibbllcoodsoccolclllllllclllllsdldbalnlobpdd",
  131. X"csiffhm`llcsgcgibllnnlllnnnnnnnn`nccsspssdckefjgssdjjsllnnlclcsbs`acsdjeeimffiiobbiifiicllllslsco`abclnlnllcllll`lclllooolcsppsc",
  132. X"ldkfefpocalolllagallnnnnnnnnnnnl`cogllsscockkjgjcoogdcl``llaabiffo``dopejrmmmes`cgbpkkrddonllllll````b`nlnllcccccdcclocsllcsqqdd",
  133. X"`skfhjglod`nnlocclao`nnnnnnnnn`aagga`lolclbpmefiaqggqbbsdo`dbjehfia`l`sjpjrpeprlocddddegradcclnlcnlccbo```ripsosppssooccllsdrpjo",
  134. X"rjehhjdosdnnldbpbolbcs``nnnnnn`daaoolnlssoskmmfrgrjihmekkqdgrrmmmiiaaosdbrsjpsclnllcssbbbbcclll```lccsblbfhmepbppjieggolcsskiigq",
  135. X"idbfhrgldsllclcsbaoaibcoqbqogadgegab`nnlaakehhfffemmhmhmhkjibrkeikbgd`losbjbpss`acll`cdagdooollnlnnlcdggmhempbssppikgbbcccgbbbii",
  136. X"cqrffebccslllllccbcgpekmimeegireekkkbacbkmmmmmmhekehmeeefhkifeppkpbba`lllppppgsgibllnnlcllccll``nnnnlobdmmmeegsbbiimribdsskiibfg",
  137. X"gdgkhkoo`llnnnnnnlspjmmfhffmfjrfedggfiibeemmmkhmfmhhfmhkkmfhhferriiol`ln`hfkpcllagallnnnnllnlla````llloaejppssscdddkkrjdjjemipmg",
  138. X"darehmrp```ln`nnnlcsdjeepjmhhfpedddgbbpisspkpkmhhhfmmmhhpihfhhiipfmgllcldhepdocdcclao`nnnllcccdiol`a`lccclllnllocdbgrmejrkfmrpea",
  139. X"iaiemjibdlol`nnll``lssjddjhihfkggdgfigggigefhkehhhfmhkfhhhhhffhfmmia`loojffkssdbpbolbbdol`ddqbdgilogaoococclnnlcssbbkkppjjmebkmg",
  140. X"ekjmmmpgbbllllnscccsccdbciifhhkdoooiqig`cbbffmkhhmkkefmmmhhhffhhmmerdoobkmmd`sssddddgqqo`cl`bq`oiaad`oobqpbcn`l`cdsddjpjikmkpmkm",
  141. X"mpmmfkjlccsslnnlllllscooogkkmhmggggggoa`oooehhehhhmkefhfhhhhhefeippbdodriekgoslcsbdbdbbscccnccaoiiidbsgdgjgibclcbsscldjkkpmeekfm",
  142. X"jikpbbalncld`lnllclnlll`lgmfmhfeffficn`nn`orhhmmhfkkjjmfeeehffbddssddbdjbmfjscllsdiqgggrsccclnlqoogbiprfkdspicccsddddjehmmhfhhee",
  143. X"ddssd`annnnnllll`llnnnnccjbemehhhfhfg`oooaimhhmmmmkejbkekjemmegdgdjggdqrqpirbc`eempbjjskppds`lldgdgdkifhfibrfialcogdrskmhkekhmmb",
  144. X"dggfiaonnnnnnllcsclnnnncsrhmpbmhkhheifqhffmmmmfkelgprsddbggjbddgbirgssbqobkjqpimhmkpqqrmmmkpbdbgdggbgffhhiijhfbclldbsjpmhmeemmeg",
  145. X"gbfiisonnnnnnnl`bscnnnnoqfhfirihhfhhhhkhfferkkbbal`aagdcsbqmfmfegggbdgogodsbpeemmhfimiimppkpsppjjgiiifhffhhmmfgc`lgirjdkerjgjbdd",
  146. X"egiffid`nnnnnnldpis`ccldiihhiirhhfmhfmmfhjddddd`annncarabggemmpjbooabblaocldjjmmemhhmogpemmbkieekprpmhfmfhhmmkgccsrpsgdqcddqmfmf",
  147. X"pcooiiicnnnnnnoopkdccgbkiepihhfhhffiikeeegdggfqaolnllbgjcqqrekrssdsbcdkqblodgjsmmhfmgocefkieaarjbrimmhhhefeipbccobkppiicccggfmmp",
  148. X"scsdrmign``nnoifbiggggddiirkfhmhhhkjddjdddgbfersdllnllsbbbjrkkqsscoodpkrbooocsjkffmkgdqmepijiikffjkeepfmmbddsssobimmsiqblcaiempj",
  149. X"cnnlrrjbibfiiqrrascdiboobiqpejikkbbdcbemefegiiriqocolllddbdgrrgao`nodjjiegg`lsgkfmhhjibfpmfhfhkhhepeejekpdsddegdgkmkpbrsllodpppb",
  150. X"lllobiifmbfhfhbbbolsmpdgojgkssddddlcagfmmppcsdgjrdpbsl``dbggikkppollsppikibalormfmhhmibjihhhhhihhmpmiqgbsdadiikbjejgsqag`nlcbpbd",
  151. X"cl`obgfmfehhffiifgboriaalbdsodggiblcaiempjsssbdjkikibocdbjdjsgbqc`nncdiifiioosremmefeidobfhhhiihhhjmfiiekjrbrkjdmejooaoaanl`abgd",
  152. X"soogbriikikmmhhfiipskkbbiqbcogbkksllodpppbsoirgjjemjfggoasssbsbbsclnldbpkkrddadpeefmerglbfhhheqrhhmfhememjkcsoloiigaoaaigollcbsa",
  153. X"bsddgdeldsddikmmemkagqpmirbbgjdigg`nlcbpbgcobfpihmpbkicbdolollllbdol`cddddegpcdgeejmergobfhhhmrfhfmfemffmms`l`n`ffiaairbgc`nlcsd",
  154. X"iadscsolnclooggekmmgsrkeeiejgdcooaanl`griggdbkihhffjpfis`lc`lnllscllnllcssbbbcsqpkppprjadhhfhhhhhhmehhmmmkdllloakhffihgaaolnlldr",
  155. X"ikgdol`nnnnnnnllkkmkbbpppikgdcccoggollbrpikiprffhhiibhfb``lnnnnnscc`acll`cdbq`cbsdjbjbksbmmfhhhhhhimhfmmhhgoolagsjirijglnnnnn`pm",
  156. X"mmmegc`nnnnnnnnbpehiq`bbiimiqcnlddgcolapejemhfhhffhhmmmbo`lnlnnnsacgibllnnlcsoscsppqbjecgrhhhhhhhhhmhhmkhhfii`qidbrhmgl`nnnncimp",
  157. X"emkkscnnnnnnnnlapkkqc`cgbpkkq`locbodlcdrimpmmfhhffhhmmmro`nnnllnolllagalllnncoclddjggjkrllsjemfhhhemmmmmefmiacbjbspjkronnnnliisj",
  158. X"pkrlooolllnnnl`obkpjjlccjdbpjbbdgc```loojimmhhhhhefeikpsocnnnn`nllcosslgdocgbdloodssbkfirsclssemhfekejkpfmhgiirebdskpkgccllsibgi",
  159. X"cbqblll`nllccnlnspmpbclcbppkpkkpqgc``onlbmmmemehffbddddssjsclcaalsdbpbocbpkrrbooolcspemmiiaacbcbrjgmjjagghmiffbksscssppdlldrgsdc",
  160. X"ooblnnodsoadc```skeiidbcgjbprkkeejjdo`llpkmmmeemmegdgjedgaeikdgssggspkgsgkeeregg`lcgppmpmefigibooloiigqpmfhhhidacscccspsscrribdl",
  161. X"caconlllcliilcsckkmkpripqppppjpppikqbalcpkkepjdgbddgbmjbsdbbbrscdjsspkkbbpppikiballcbrdjiekkggriq``ffjbqmfrhfillcclcekpdspkkpjso",
  162. X"gggo`cclllelnllgeekjpeikrjkgglbbiimridacqsbccolbkpirbggddkijjqgqprdgperq`bbiifiio`llbibdjbjjjgrfiaakhfikmmifhaslsskffmepsriiejrr",
  163. X"sdoaoaclnnlnnndjmmpkkekpkjpbcllgbpkjrgddssdal`nocscdlllclrrkfgbiejqrbbkc`cgbpkkrddllcgdsggqpjrqibaasjirrkhiffaolcsmhhmfiqmkkikem",
  164. X"kggllodlnnnnnnspempppppijgdsdnlcdddsesdcdsrrgd`lllllsl`oogijeaaiefkkpbsrlocddddegbocsodsdirkprkaaaq`bkfkkhhhmejapmmhfemhmmagdamh",
  165. X"kqsa`a`llnl`nndjeii`bbiimiroclnllcssdccclsjbbacnnllscoerkprrigabhfekppsclnllcssbbbpscassdpkekpkid`a`cjemmhmhpkdbkkepmmhfmdolllpm",
  166. X"hfioo`olonl`lnlbpkc`cgbpkkrsclcclnllolllssagiqosnldsffhmffemfmrihmmerpsllacll`cdagdclascsjmerpmffo``ookeepmmeeeskbdeeffmkd`lldff",
  167. X"ihhba`ololn`nnlsppilocdddgejcdbbllnnlnnnaarggiadrrsskhrhmemmhhhhhfmempdldibllnnldccsloooqmkpjekffia`losagjemmigddciiifehhgo`laai",
  168. X"fhhgioqcgonnnnlssscnnllcssbbalco`llllnlcrfhfsgoifiiqihhfffmffhhhhhimmmdllbdallllcosoccoiqhkiiffmeiiaolspppppmfriiiiffffhmfga`o`g",
  169. X"fmhgaoqbbbcllnlsbsc`clnnnldddolln`l`obddejmfg`o`aiggrhhmefhhhhhhhhmmhmpsdsscbsocdcc`odrigiimfmhirpbdolcbdsdpmiiifiihhmhemea`nnni",
  170. X"fjfaiiqrimpcdbdjdgcoo`nnnnlcsllnllcoddpkssbbcll`caiemmhfibdjemfhhhjkeejpdppdsjjppdoccqiioobmfhhkpkqblolclsrepmffmmkmkmjmemdd`nai",
  171. X"rioogfrjffibrpdddsoc`lnnnnnnnlnl```iggggidqo`n`nnnogpmfhkdllssemhfjppbpscsjqjjpppbdldifddlbmhhhkrrrb`clnlpksjefkmpjdemebmkgfiiir",
  172. X"qqdoqfikiijbdjdsdgoo`nnnnlnnnlll`l`qqig`lc``nnnnnnn`cbpsbqodcbcbrjgijgdgsbkkjjbbbbaasreia`bfmhhmkeeeggllcibgipkksgefpmmmmfmmfmhq",
  173. X"ihgcrfmpeldsdbbcqqbqbnnnlll`cssddddggool`l`lnnnnnnnnlloddiiqaiboolopdcsscsrjmkjgda`gbjefkadhhmhmmiikqsocdsssccqibdisbpkekpkkjjmj",
  174. X"errbbpbballcoagdiibkpcllolssccbgifficnnnnnnnnnnnnnnnlloadjrjdgriq``iidl`sdsdkrggqd`a`spiebbmmmffkmifrjsbsbsoncdqddjslscsssbpbdki",
  175. X"sjkbodd`anlcbprsimikrb`oosbdcsbrmfhfg```nnnnnnnnnnnnnlcbddjpigrfiaakfrddgboomeriffo``dgmfogihmmmibppkbddolll`bdbdsbdslllccssolls",
  176. X"lsjjgiiaolldqhkrejiegiiqaggolcspshheifqfqb`nnnnnnnn`nldbbjpbiiqibaasprgdgqaokfiiffiaocqkerllsjkmrjsbpjdda`lcgbgbgspibsllccdegcnn",
  177. X"logpiiisolncjehkihmbspidqgdgoocbkmhhhhpmmgannnnnnnl`coacbkmkrriaaaq`brergbaasjrmimiqaagkmiqcclssppppbdcsdscsbrrrdspjbddcskfmjsnn",
  178. X"cgrjgiaaollbbpmfhhffrihiegggoc`depehhhmffgg`nnnnn`aagga`sjrkrrkid`a`creradogobieiiqbgabqmifiaacbsbbdsbdspejpmhkpgsqccccbsmhmkpcl",
  179. X"bpkrgdoaaolbiprhfhhiirhhekkkba`cbkiiipijjjgonnnnn`daaoollsjkkpfhfo``o`kkqd`a`srkkrbbcbapmehhfiigsodsdpdspjqkhfkkiicccggemmhmjjds",
  180. X"ddekjgiqfiarmhhhhffhhfmhebjgbododpkeldsssgbgbqogadgegab`nldjdemhfia`l`skifo``odkrgqgolajrjefmeggpiqadpgsgdkkhhhbiqblcbgkkepmekds",
  181. X"skeffffpffmmkmhhhffhhmmfeddjd`o`cbbbllllclbpeeegireekkkb`cabgjfmmiiaaossifiaocoprpbboldgieekmkigrfigakfisbdemmkpbrsllospbsjkmksc",
  182. X"rfiihhhmhhkfkmhhhhefeikpddrifo``o`bgclnllnljkfmfjrfedggigdobbqjiipbgo`lbjkiraadbrfoo``lggjemkpiiqiqiisjqbsgrejgsqag`nlcbsriifrqd",
  183. X"pmmmiikikmmmmkeehffbddsdoodifib`llcbsbccolocgmhhfpedddgbdlcaigkkrbbca`asbppbboosrfibol`cqsmhhmrriagaiobrdockejooaoaanl`gjriffgrp"
  184. X};
  185. END_OF_FILE
  186.   if test 17329 -ne `wc -c <'bitmaps/background10.xpm'`; then
  187.     echo shar: \"'bitmaps/background10.xpm'\" unpacked with wrong size!
  188.   fi
  189.   # end of 'bitmaps/background10.xpm'
  190. fi
  191. if test -f 'bitmaps/presents.xpm' -a "${1}" != "-c" ; then 
  192.   echo shar: Will not clobber existing file \"'bitmaps/presents.xpm'\"
  193. else
  194.   echo shar: Extracting \"'bitmaps/presents.xpm'\" \(18609 characters\)
  195.   sed "s/^X//" >'bitmaps/presents.xpm' <<'END_OF_FILE'
  196. X/* XPM */
  197. Xstatic char * presents_xpm[] = {
  198. X"410 44 16 1",
  199. X"     s None    c None",
  200. X".    c #F0F0F0F0F0F0",
  201. X"X    c #E0E0E0E0F0F0",
  202. X"o    c #D0D0D0D0F0F0",
  203. X"O    c #C0C0C0C0F0F0",
  204. X"+    c #B0B0B0B0F0F0",
  205. X"@    c #A0A0A0A0F0F0",
  206. X"#    c #90909090F0F0",
  207. X"$    c #80808080F0F0",
  208. X"%    c #60607070F0F0",
  209. X"&    c #50506060F0F0",
  210. X"*    c #40405050F0F0",
  211. X"=    c #30304040F0F0",
  212. X"-    c #20202020F0F0",
  213. X";    c #10101010F0F0",
  214. X":    c #00000000F0F0",
  215. X"                                                                                                                                                                                          ...........                                                                                                                                                                                              ...........            ",
  216. X"                             ........                                       ..............                                          ............                                      XXXXXXXXXXXXXXXXX                                 ............                           ....                                                  .....................                                     XXXXXXXXXXXXXXXXX          ",
  217. X"                    X.X.X.X.X.X.X.X.X.X.X                              .X.X.X.X.X.X.X.X.X.X.X.                              X.X.X.X.X.X.X.X.X.X.X.X                                XXXXXXXXXXXXXXXXXXXXX                        X.X.X.X.X.X.X.X.X.X.X.X                       X.X.X.X.X                   X.X                     X.X.X.X.X.X.X.X.X.X.X.X.X                                 XXXXXXXXXXXXXXXXXXXXX         ",
  218. X"                 XXXXXXXXXXXXXXXXXXXXXXXXXX                         XXXXXXXXXXXXXXXXXXXXXXXXXXXX                         XXXXXXXXXXXXXXXXXXXXXXXXXXX                            XoXXXoXXXoXXXoXXXoXXXoXXX                    XXXXXXXXXXXXXXXXXXXXXXXXXXX                      XXXXXXXXXX                 XXXXX                XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX                             oXXXoXXXoXXXoXXXoXXXoXXXo        ",
  219. X"                oXoXoXoXoXoXoXoXoXoXoXoXoXoXo                       XXoXXXoXXXoXXXoXXXoXXXoXXXoXX                       oXoXoXoXoXoXoXoXoXoXoXoXoXoXo                        oooooooooooooooooooooooooooo                   oXoXoXoXoXoXoXoXoXoXoXoXoXoXo                     oXoXoXoXoX                oXoXoXo             oXoXoXoXoXoXoXoXoXoXoXoXoXoXoXoXo                         oooooooooooooooooooooooooooo        ",
  220. X"                oooooooooooooooooooooooooooooo                      oooooooooooooooooooooooooooooo                      ooooooooooooooooooooooooooooo                      ooooooooooooooo    ooooooooooo                   ooooooooooooooooooooooooooooo                       ooooooooo              ooooooooo            oooooooooooooooooooooooooooooooooo                      ooooooooooooooo    ooooooooooo        ",
  221. X"                    ooooooooooooooooooooooooooo                       ooooooooooooooo     ooooooooo                      oooooooooooooo                                   OoOoOoOoOoOo        OoOoOoOoOo                     oooooooooooooo                                     ooooooooo              oooooooooo           oooooooooooooooooooooooooooooooooo                     oOoOoOoOoOoO        oOoOoOoOoO         ",
  222. X"                   OOOOOOOOOOOO     OOOOOOOOOOO                       oooOoooOoooO          oOoooOoo                       OOOOOOOOOOO                                   OOOOOOOOOOO         OOOOOOOOOO                        OOOOOOOOOOO                                     OoOoOoOOOo             OOoOoOoOOO             OOOOOOOOOOOOOOOOOOOOOOOO                             OOOOOOOOOOO         OOOOOOOOOO          ",
  223. X"                  OOOOOOOOOO          OOOOOOOOOO                       OOOOOOOOOO            OOOOOOO                       OOOOOOOOOO                                   OO+OOO+OOO+         OO+OOO+OOO                         OOOOOOOOOO                                      OOOOOOOOOOO            OOOOOOOOOO                     OOOOOOOOOOOOO                               O+OOO+OOO+O         O+OOO+OOO+           ",
  224. X"                 OOOOOO+OOO            +OOOOOOO+                       OOOOOOOOO             OOOOOOOO                     OOOOO+OOOO                                    ++++++++++         ++++++++++                         O+OOOOOOO+                                      OOOOOOOOOOOO           OOOOOOOOOO                       O+OOOOOOO+O                                ++++++++++         ++++++++++            ",
  225. X"                 +++++++++             +++++++++                      +O+O+O+O+              O+O+O+O+                     +++++++++                                    ++++++++++          ++++++++                           +++++++++                                      O+O+O+O+O+O+O          +O+O+O+O+O                        ++++++++++                                ++++++++++          ++++++++              ",
  226. X"                ++++++++++            ++++++++++                      +++++++++             ++++++++                     +++++++++                                     @+@+@+@+@                                             +++++++++                                       +++++++++++++          ++++++++++                        +++++++++                                 +@+@+@+@+                                 ",
  227. X"               +@+@+@+@+@            +@+@+@+@+@                      +@+++@+++             +++@+++@+                    @+@+@+@+@                                      @@@@@@@@                                             @+@+@+@+@                                       @+@+@+@+@+@+@+@        +@+@+@+@+@                        +@+@+@+@+                                  @@@@@@@@                                  ",
  228. X"              @@@@@@@@@@            @@@@@@@@@@@                     @@@@@@@@@            @@@@@@@@@@                    @@@@@@@@@@                                      @@@@@@@@                                            @@@@@@@@@@                                      @@@@@@@@@@@@@@@@        @@@@@@@@@                         @@@@@@@@@                                  @@@@@@@@                                  ",
  229. X"              #@#@#@#@#@          #@#@#@#@#@#@                      @@@@@@@@@          @@@@@@@@@@@                    #@#@#@#@#@                                       @#@###@#                                           #@#@#@#@#@                                       @@@@@@@@@@@@@@@@       @@@@@@@@@@                        #@#@#@#@#                                   #@###@#@                                  ",
  230. X"             ##########          ############                      @@#@@@#@@         #@@@#@@@#@@@                    ###########                                       #########                                         ###########                                      ##@###@###@###@##       ##@###@##                        #########                                    #########                                 ",
  231. X"            ###########        #############                      ##########       #############                    ############                                       #$#$#$#$#$#                                      ############                                      #################      #########                         ########                                     $#$#$#$#$#$                               ",
  232. X"           $$$$$$$$$$$       $$$$$$$$$$$$$$                      ##############################                     $$$$$$$$$$$$$$$$$$$$$$                              $$$$$$$$$$$$                                    $$$$$$$$$$$$$$$$$$$$$$                           ###################     #########                        $$$$$$$$$                                      $$$$$$$$$$$$                             ",
  233. X"           $$$$$$$$$$      $$$$$$$$$$$$$$$                       #$#$#$#$#$#$#$#$#$#$#$#$#$#$                      $$$$$$$$$$$$$$$$$$$$$$$$                             $$$$$$$$$$$$$$                                 $$$$$$$$$$$$$$$$$$$$$$$$                         $#$#$#$$$#$#$#$$$#$#    $#$#$#$$$                        $$$$$$$$$                                       $$$$$$$$$$$$$$                           ",
  234. X"          $$$%$$$%$$$    %$$$%$$$%$$$%$$$                       $$$$$$$$$$$$$$$$$$$$$$$$$$$                       $$$%$$$%$$$%$$$%$$$%$$$%$                               %%%%%%$%%%%%%                               $$$%$$$%$$$%$$$%$$$%$$$%$                         $$$$$$$$$  $$$$$$$$$    $$$$$$$$                         %$$$%$$$                                          %%%%%$%%%%%%%                          ",
  235. X"         %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%                        $$$$$$$$$$$$$$$$$$$$$$$$$$                         %%%%%%%%%%%%%%%%%%%%%%%%%                                %%%%%%%%%%%%%                              %%%%%%%%%%%%%%%%%%%%%%%%%                        $%$%$%$%$   $%$%$%$%$   $%$%$%$%$                        %%%%%%%%%                                           %%%%%%%%%%%%%                         ",
  236. X"         %%%%%%%%%%%%%%%%%%%%%%%%%%%%                          %%%%%%%%%%%%%%%%%%%%%%%                           %%%%%%%%%%%%%%%%%%%%%%%%                                    %%%%%%%%%%%%                            %%%%%%%%%%%%%%%%%%%%%%%%                          %%%%%%%%     %%%%%%%%%%%%%%%%%%%                        %%%%%%%%%                                              %%%%%%%%%%%%                        ",
  237. X"        %%%%%%%%%%%%%%%%%%%%%%%%%%%                           %%%%%%%%%%%%%%%%%%%%%                             %%%%%%%%%%%%%                                                  %%%%%%%%%%%                          %%%%%%%%%%%%%                                     %%%%%%%%%     %%%%%%%%%%%%%%%%%%%                        %%%%%%%%%                                                %%%%%%%%%%%                       ",
  238. X"        %&%%%&%&%&%%%&%&%&%%%&%&%                            %%%%%%%%%%%%%%%%%%%%%                              %&%%%&%&%&%                                                      &&&&&&&&&&                         %&%&%&%%%&%                                      %%%%%%%%%      %%%%%%%%%%%%%%%%%%                        %&%&%%%&%                                                   &&&&&&&&&&                      ",
  239. X"       &&&&&&&&&&  &&&&&&&&&&&&                             %%%%%%%%%%%   %%%%%%%%                             &&&&&&&&&&&                                                        &&&&&&&&&                        &&&&&&&&&&&                                       %&%&%&%&%      &%&%&%&%&%&%&%&%&                        &&&&&&&&&&                                                    &&&&&&&&&                      ",
  240. X"      &&&&&&&&&&&   &&&&&&&&                                &&&&&&&&&&    &&&&&&&&&                            &&&&&&&&&&                                                          &&&&*&&&                        &&&&&&&&&&                                       &&&&&&&&&        &&&&&&&&&&&&&&&&                        &&&&&&&&&                                                      &&&*&&&&                      ",
  241. X"      ***&*&*&**                                           &&&&&&&&&&      &&&&&&&&                           ***&*&*&***                                                          ********                       *&*&***&*&*                                       &&&&&&&&&        &&&&&&&&&&&&&&&                        *&***&*&*                                                       ********                      ",
  242. X"     ***********                                          &&&&&&&&&&&      &&&&&&&&&                          **********                                                           ********                       **********                                       *&***&***         ***&***&***&***                        *********                                                       ********                      ",
  243. X"    =*=*=*=*=*=                                           *&***&***&       &***&***&                         *=*=*=*=*=*                                                           *=*=*=*=                      *=*=*=*=*=*                                      **********         **************                        *=*=*=*=*                                                        =*=*=*=*                      ",
  244. X"    ==========                                           ***********        ********                        ===========                                                           ========                      ===========                                       *********          **************                       ==========                                                       ========                       ",
  245. X"   ===========                                          =*=*=*=*=*=         =*=*=*=*=                       ===========                                                          =========                      ===========                                      ====*=====           =======*====                        =========                                                       =========                       ",
  246. X"   ==========                                           ==========          =========                       ==========                                        ====              =========                       ==========                                       =========            ============                       ==========                                    ====              =========                        ",
  247. X"  ===========                                          ===========           =========                     ===========                                       ======           ==========                       ===========                                      ==========            ===========                        =========                                    ======           ==========                         ",
  248. X" ==-=-=-===-                                           ==========            =========                     -=-=-===-=-          ===-=-=-                    =-=-=-=-      =-=-=-=-=-=-=                        -===-=-=-==          =-=-===-                    =========             ===========                       ===-=-=-==                                   -=-=-=-=      -=-=-=-=-=-=-                          ",
  249. X" ----------                                           ===========             =========                    -----------------------------                   ---------------------------                         -----------------------------                   ==========             ==========                        ---------                                   ---------------------------                           ",
  250. X"-----------                                           ==========              =========                    -----------------------------                   -------------------------                           -----------------------------                   -=---=---              --=---=---                       ----------                                   -------------------------                             ",
  251. X";;;-;;;-;;                                            -=---=---                =---=---=                    ;;;-;;;-;;;-;;;-;;;-;;;-;;;                     ;;;-;;;-;;;-;;;-;;;-;;                              ;;;-;;;-;;;-;;;-;;;-;;;-;;;                    ---------              ----------                       -;;;-;;;-                                     ;;-;;;-;;;-;;;-;;;-;;;                               ",
  252. X";;;;;;;;;;                                             --------                ----------                   ;;;;;;;;;;;;;;;;;;;;;;;;;                        ;;;;;;;;;;;;;;;;;;;                                ;;;;;;;;;;;;;;;;;;;;;;;;;                      --------               ---------                        ;;;;;;;;;                                      ;;;;;;;;;;;;;;;;;;;                                 ",
  253. X" ;:;:;:;:                                               ;-;-;-                  ;-;-;-;-;-                   ;:;:;:;:;:;:;:;:;:;                               ;:;:;:;:;:;:;:                                    ;:;:;:;:;:;:;:;:;:;                            ;;;;;;;               ;;;;;;;;;                        ;:;:;:;                                          :;:;:;:;:;:;:;                                    ",
  254. X"   ::::                                                  ;;;;                   ;;;;;;;;;;;                     :::::::::                                         :::::::                                           :::::::::                                     ;;;;;               ;;;;;;;;;                        :::::                                               :::::::                                        ",
  255. X"                                                                                 ;;;;;;;;;;;                                                                                                                                                                                            :;:;:;                                                                                                                            ",
  256. X"                                                                                  ;:;:;:;:;:                                                                                                                                                                                              ::::                                                                                                                            ",
  257. X"                                                                                   :::::::                                                                                                                                                                                                                                                                                                                                ",
  258. X"                                                                                                                                                                                                                                                                                                                                                                                                                          "};
  259. END_OF_FILE
  260.   if test 18609 -ne `wc -c <'bitmaps/presents.xpm'`; then
  261.     echo shar: \"'bitmaps/presents.xpm'\" unpacked with wrong size!
  262.   fi
  263.   # end of 'bitmaps/presents.xpm'
  264. fi
  265. if test -f 'xboing.man' -a "${1}" != "-c" ; then 
  266.   echo shar: Will not clobber existing file \"'xboing.man'\"
  267. else
  268.   echo shar: Extracting \"'xboing.man'\" \(15337 characters\)
  269.   sed "s/^X//" >'xboing.man' <<'END_OF_FILE'
  270. X.TH XBOING 6 "August 1993" "X Version 11"
  271. X.SH NAME
  272. X
  273. X\fIxboing\fP \- An X Window System based blockout clone. V1.6
  274. X
  275. X.SH SYNOPSIS
  276. X
  277. X\fIxboing\fP [-version] [-usage] [-help] [-sync] [-display <displayName>] [-speed <1-10>] [-scores] [-keys] [-sound] [-setup] [-nosfx] [-pointergrab] [-maxvol <1-100>] [-startlevel <1-MAXLEVELS>]
  278. X
  279. X    -speed <n>         - The game speed, 1 - 9. 9=Fast
  280. X    -maxvol <n>        - The maximum volume as percentage
  281. X    -startlevel <n>    - The starting level for game.
  282. X    -help              - Produce this help message.
  283. X    -sync              - Turn on X synchronisation.
  284. X    -usage             - Print a brief help message.
  285. X    -version           - Print out the current version.
  286. X    -scores            - Print out current highscores.
  287. X    -keys              - Use keys instead of mouse control.
  288. X    -sound             - Turn audio ON for game.
  289. X    -setup             - Print setup information.
  290. X    -nosfx             - Turn off special effects.
  291. X    -pointergrab       - Turn pointer grabbing on.
  292. X    -display <display> - Set the display for the game.
  293. X
  294. X.SH DESCRIPTION
  295. X
  296. X\fIXBoing\fP is a simple blockout type game where you have a paddle which you control to bounce a ball around the game area destroying blocks with the proton ball. 
  297. X
  298. XEach block carries a different point value. The more blocks you destroy, the better your score. The person with the highest score wins.
  299. X
  300. XThe play area is filled with blocks and other objects. You have a paddle that
  301. Xcan move from left to right at the bottom of the arena. You move the paddle
  302. Xso that the proton ball bounces around blowing up blocks does not go past the
  303. Xpaddle and out the bottom, much like a pinball game.
  304. X
  305. XThe blocks exhibit different behaviour. The bomb block when hit will explode all
  306. Xblocks around it. If another bomb is beside it then it will go off also. The
  307. Xsolid wall brick will not explode unless next a bomb. The ammunition block will
  308. Xgive you four bullets and so on. Special blocks such as reverse and machine gun will only last for one level.
  309. X
  310. XThere are random blocks that change their colour and therefore their points every now and then. They add a bit of change to the levels.
  311. X
  312. XThere is a pirate symbol that will kill your ball if touched. You can shoot this block 3 times to kill it but you will lose 1000 points. Keep away from the Death block, it kills your ball!
  313. XThe walls off block will turn the wall bounce off on both the left and right side of the playing area. This will mean the ball will not bounce off but continue through the wall and wrap around to the other side respectively.
  314. X
  315. XThe reverse block will when hit reverse the controls to the paddle. This block should be avoided as it makes the game really hard. Hitting another reverse while already in reverse mode will turn it off.
  316. X
  317. XThe teleport block will teleport the ball somewhere else on that level. It will not place you too close to the bottom of the screen or on another block.
  318. X
  319. XThe sticky paddle block will stick the ball to your paddle each time it is hit and wait until you press space to shoot it off again. This can be a #$%$#@! and also useful for lining up shots for hard bricks.
  320. X
  321. XThere is a machine gun block that allows you to shoot much faster. Note that you will also go through your bullets at a great rate. Can be fun to let off a burst every now and then. Erases counter blocks very fast.
  322. X
  323. XAn extra ball symbol may appear and when shot or hit with another ball it will give you an extra ball!
  324. X
  325. XThere is a shrink paddle block that will shrink you paddle to a smaller size for the level. If you currently have the smallest paddle then it has no effect.
  326. X
  327. XThere is an expand paddle block that will grow you paddle to a larger size for the level. If you currently have the largest paddle then it has no effect.
  328. X
  329. XYou can use the bullets to shoot the last pesky blocks or to collet lots of
  330. XYou can use the bullets to shoot the last pesky blocks or to collet lots of
  331. Xbonus coins. You will be given 4 bullets when a new level starts. If you lose
  332. Xa ball you will be given a token 2 bullets. Use bullets wisely as you will
  333. Xhate yourself when there is one brick left and the ball is missing it for ever.
  334. X
  335. XThroughout the game the bonus coins will appear. Collect these for bonus points when the level is finished. Sometimes the coin may appear as a x2 or x4 symbol which will indicate that the scoring from now onwards will be multiplied by 2 or 4 respectively. Note: if you get a x2 then x4 then x2 you will go back to x2 mode. Also note that this x2 or x4 mode will be disabled after each ball death.
  336. X
  337. XIf you collect more than 10 bonuses during a level the killer mode is activated which will turn the ball red and the ball will plough through all blocks except the solid ones and finish off the level very quickly. You will also receive the SUPER BONUS on the bonus screen.
  338. X
  339. XThe bonus screen will tell you how you went in the last level. Your bonuses
  340. Xwill be added and the bullet and level bonus will be added. You get 500 points
  341. Xfor each bullet not used. You get 3000 points for each bonus and if you get
  342. Xmore than 10 bonuses you get a SUPER BONUS of 50000 points. You also get a new
  343. Xball every 100,000 points. Pressing space will skip the bonus animations when
  344. Xthe bonus screen appears. Your bonus score will still be added.
  345. X
  346. XThere is a level timer that counts down while playing the level. If you don't
  347. Xcomplete the level in time you will not get the time bonus which is 100 points
  348. Xper second remaining. You will also miss out on the level bonus if your time runs out.
  349. X
  350. XThe ball will be automatically shot off the paddle after about 5 seconds unless you press the space bar. You can always press P to pause the game.
  351. X
  352. XIf the ball gets stuck in an infinite loop it will automatically tilt the board if the ball hasn't hit the paddle after a certain time span. The time span is about 8 seconds I think.
  353. X
  354. XXBoing was started like many other projects to learn Xlib better. I had the
  355. XXPM library and was already using it in a Motif application. I thought that it
  356. Xwould be cool to have nice colour pictures/animations in an Xlib game. So I
  357. Xdid. Without the XPM library I would be still playing with the colours I think.
  358. X
  359. X.SH OPTIONS
  360. X
  361. XThe \fIspeed\fP option will adjust the speed of the overall game. It will except integer numbers between 1 and 9. This option is a little dodgy. The speed of the game can be changed from within the game as well. See Game Control. The default value is 1.
  362. X
  363. XThe \fImaxvol\fP option allows you to adjust the maximum volume to be used for the sound effects if sound is supported. It doesn't mean all sounds will be this volume but they will use that volume as the top volume to scale against.
  364. X
  365. XThe \fIstartlevel\fP option allows you to set the starting level for your games. Note that when your score is placed in the highscore table the level number is the number of levels completed and not the level number attained. Also, in the bonus screen your level bonus will be the number of levels completed multiplied by the level bonus value and not the current level number!
  366. X
  367. XThe \fIhelp\fP option will display a brief one line description of all the command line options used with xboing.
  368. X
  369. XThe \fIsync\fP option will turn on the X Window System synchronisation of all Xlib calls which means that all calls are flushed by the X server before continuing. This will cause the game to become slower but enable some debugging. The default is OFF.
  370. X
  371. XThe \fIusage\fP option will print a very brief synopsis of all the command line options and there value ranges.
  372. X
  373. XThe \fIversion\fP option prints the version of xboing that you are running.
  374. X
  375. XThe \fIscores\fP option will print both the roll of honour and your personal best scores to standard out. This can be useful if you are not running the program on an X window display and still want to see what the scores are.
  376. X
  377. XThe \fIkeys\fP option will enable the use of the keyboard for game control. Within the game you may press <g> to toggle between mouse and key control. The default is MOUSE control.
  378. X
  379. XThe \fIsound\fP option will enable sound to be turned on if possible. The default is OFF.
  380. X
  381. XThe \fIsetup\fP option is useful when you have just compiled the program. It will display the paths of the level & sound directories and also give you some information on other things.
  382. X
  383. XThe \fInosfx\fP option will turn OFF special effects. The special effect in question at this stage is the explosion shake. Turning it off will speed the game up a little bit. The default is ON. Servers without backing store will have it turn off automatically as the shaking is shocking.
  384. X
  385. XThe \fIpointergrab\fP option will grab the pointer when the game is visible. This has the effect of stopping you move the pointer outside the game window. This is useful as it constrains the mouse and you don't get colourmap flashes. The default is OFF.
  386. X
  387. XThe \fIdisplay\fP option will allow you to force the game to be viewed on another display. The format of the display name is <xserver:0.0> like most other programs where xserver is the name of the display. The default is your display of course.
  388. X
  389. XYou may also set three environment variables used by xboing. They specify the location of the level files, sounds and the highscore file. They are listed below.
  390. X
  391. XXBOING_SCORE_FILE = the highscore file to be used.
  392. XXBOING_LEVELS_DIR = the directory containing the levels.
  393. XXBOING_SOUND_DIR  = the directory containing the sounds.
  394. X
  395. XThey will override the settings that are compiled into the program.
  396. X
  397. X.SH GAME CONTROL
  398. X.PP
  399. XYou must have specified "-keys" on the command line to use the keys for
  400. Xthe paddle control. The default is to use the mouse control method.
  401. X.nf
  402. X
  403. XJ = Paddle Left
  404. XLeftArrow = Paddle Left
  405. XK = Shoot bullet
  406. XL = Paddle Right
  407. XRightArrow = Paddle Right
  408. X
  409. XAll Mouse Buttons = Shoot Bullet/Start ball
  410. X
  411. XUse the mouse to move the paddle left and right by moving the mouse 
  412. Xleft and right. The paddle will follow the mouse pointer. This is
  413. Xthe best method and easiest to use by far.
  414. X
  415. XSpace   = Start game
  416. XEscape  = End game and return to introduction.
  417. Xi       = iconify the game and pause.
  418. XH       = View roll of honour.
  419. Xh       = View personal highscores.
  420. Xp       = Pause game.
  421. Xd       = Kill the ball.
  422. Xa       = Toggle audio on/off
  423. Xs       = Toggle special effects on/off
  424. Xc       = Cycle through the intro screens.
  425. X1-9    = Game speed where 9 is fastest.
  426. Xq       = Quit XBoing
  427. X
  428. XNote: Highscores are saved at the end of each game.
  429. X.fi
  430. X.PP
  431. X.SH SCORING
  432. X
  433. XEach blocks has a certain point score. Some blocks such as the counter block will have more than one score associated with it.
  434. X
  435. X.nf
  436. Xred = 100
  437. Xblue = 110
  438. Xgreen = 120
  439. Xyellow = 140
  440. Xtan = 130
  441. Xpurple = 150
  442. Xbomb = 50 plus the surrounding blocks points
  443. Xwall = 0
  444. Xpirate = 100
  445. Xreverse = 100
  446. Xammo = 50 plus bullets
  447. Xcounter = 200 (each number). 
  448. X.fi
  449. X
  450. XEach time the paddle is hit with the ball your earn 10 points. I'm nice.
  451. X
  452. XThere are death symbols (a pirate) that when hit by a ball will kill the ball. You can shoot them but you will lose 1000 points.
  453. X
  454. XThe bonus coins are 3000 points - but only added to score if you reach the end of the level and go through the bonus screen.
  455. X
  456. XIf you collect more than 10 bonus coins you get a Super Bonus of 50,000 points. Each remaining bullet after a level is worth 500 points.
  457. X
  458. XAt the end of each level you are awarded a level bouns which is level <n> x 1000 points. So for level 20 you get 20,000 points! If you fail to complete the level in the time allotted you will not receive a level bonus.
  459. X
  460. XThere are now two highscore files. One displays the global scores which will be your best score to date. The other is a personal high score table with all your attempts.
  461. X
  462. X.SH SOUND SUPPORT
  463. X
  464. XXboing has limited support for sound. It has sound code for the following machines :-
  465. X
  466. XHP, SUN, NCD Xterminals, LINUX PC Soundblaster
  467. X
  468. XMost support and use the SUN .au format sound files. The linux version just sends the data down to the audio device which may cause slight clicking sounds due to the audio file header. Future versions of xboing will support other machines if patches are sent to me or if I learn the sound format. SGI will be next but they have their own format, argghh. I am not going to have heaps of converted files all over the place in different formats as the archive would be HUGE.
  469. X
  470. X.SH LEVELS
  471. X
  472. XThe levels are not increasingly harder to play - some are but some are easy. This is because it takes ages to create and design levels. The paddle does get smaller as the game goes on. This makes it REALLY hard. I may also add a ball speedup feature.
  473. X
  474. XThe level data is a simple ASCII file format that can be edited. The levels
  475. Xare loaded when required from the directory specified when the game was made.
  476. X
  477. XYou can create more levels if you like making sure that they are in the correct
  478. Xformat and that they have a correct filename format.
  479. X
  480. XCopy level0.data to level??.data and use that for the editing of new levels.
  481. X
  482. Xlevel format:    (case sensitive)
  483. X
  484. X    w = wall block
  485. X    r = red block
  486. X    g = green block
  487. X    b = blue block
  488. X    t = tan block
  489. X    p = purple block
  490. X    y = yellow block
  491. X    X = Bomb
  492. X    B = Ammo
  493. X    . = blank
  494. X    D = Death
  495. X    R = Reverse
  496. X    H = Teleport
  497. X    L = Extra ball
  498. X    M = Machine Gun
  499. X    W = Walls off
  500. X    ? = Random block
  501. X    m = Multiple balls
  502. X    s = sticky block
  503. X    < = Shrink paddle block
  504. X    > = Grow paddle block
  505. X
  506. XThe format of the level is shown in the newlevel.data file in the source distribution in the levels directory.
  507. X
  508. XMake sure you have a level title and a time bonus in seconds.
  509. X
  510. X.SH NOTES
  511. X
  512. XObatin all new versions from export.lcs.mit.edu or a mirror site.
  513. X
  514. X.SH REDISTRIBUTION 
  515. X
  516. X(c) Copyright 1993, Justin C. Kibell, All Rights Reserved
  517. X
  518. XPermission to use, copy, modify, and distribute this software and its documentation without written agreement is hereby granted. You cannot sell this software without written permission from the author. This entire copyright notice must appear in all copies of this software.
  519. X
  520. XIN NO EVENT SHALL THE AUTHOR BE LIABLE TO ANY PARTY FOR DIRECT, INDIRECT, SPECIAL, INCIDENTAL, OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OF THIS SOFTWARE AND ITS DOCUMENTATION, EVEN IF THE AUTHOR HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGE.
  521. X
  522. XTHE AUTHOR SPECIFICALLY DISCLAIMS ANY WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE.  THE SOFTWARE PROVIDED HEREUNDER IS ON AN "AS IS" BASIS, AND THE AUTHOR HAS NO OBLIGATION TO PROVIDE MAINTENANCE, SUPPORT, UPDATES, ENHANCEMENTS, OR MODIFICATIONS.
  523. X
  524. X.SH AUTHOR
  525. X
  526. XJustin C. Kibell - Systems Programmer - CATT Centre CITRI Melbourne - Victoria - Australia.  email: jck@citri.edu.au
  527. XSnailMail: 1/17 Albert Road, North Warrandyte, Victoria, Australia, 3113
  528. X
  529. XComputer Science Graduate - Royal Melbourne Institute of Technology (RMIT) - Australia
  530. X
  531. X.SH BUGS
  532. X
  533. XSee TODO and CHANGES documents in source distribution for list of bugs and bug fixes. 
  534. X
  535. XMail all bug reports/suggestions to jck@citri.edu.au specifying the version and machine type you are using. Use 'uname -a' to explain the machine type. Please note the version of X11 that you have installed as well, ie: X11R5, X11R4, etc.
  536. X
  537. XPlease note that xboing will run like a pig on the xnews X server distributed with Sun machines. Please try to use the MIT X Server that comes with the X Window System.
  538. END_OF_FILE
  539.   if test 15337 -ne `wc -c <'xboing.man'`; then
  540.     echo shar: \"'xboing.man'\" unpacked with wrong size!
  541.   fi
  542.   chmod +x 'xboing.man'
  543.   # end of 'xboing.man'
  544. fi
  545. echo shar: End of archive 11 \(of 26\).
  546. cp /dev/null ark11isdone
  547. MISSING=""
  548. for I in 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 ; do
  549.     if test ! -f ark${I}isdone ; then
  550.     MISSING="${MISSING} ${I}"
  551.     fi
  552. done
  553. if test "${MISSING}" = "" ; then
  554.     echo You have unpacked all 26 archives.
  555.     rm -f ark[1-9]isdone ark[1-9][0-9]isdone
  556.     echo "merging split files..."
  557.     cat blocks.c[12] > blocks.c
  558.     rm blocks.c[12]
  559.     echo "blocks.c done"
  560.     cat bitmaps/earth.xpm.Z.u.[ab] > bitmaps/earth.xpm.Z.uue
  561.     rm bitmaps/earth.xpm.Z.u.[ab]
  562.     echo "bitmaps/earth.xpm.Z.uue done"
  563. else
  564.     echo You still must unpack the following archives:
  565.     echo "        " ${MISSING}
  566. fi
  567. exit 0
  568. exit 0 # Just in case...
  569. -- 
  570.   // chris@Sterling.COM           | Send comp.sources.x submissions to:
  571. \X/  Amiga - The only way to fly! |    sources-x@sterling.com
  572.  "It's intuitively obvious to the |
  573.   most casual observer..."        | GCS d+/-- p+ c++ l+ m+ s++/+ g+ w+ t+ r+ x+
  574.